DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and VCX3A

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_057463.2 Gene:VCX3A / 51481 HGNCID:18159 Length:186 Species:Homo sapiens


Alignment Length:152 Identity:39/152 - (25%)
Similarity:74/152 - (48%) Gaps:21/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 KVKTTAI-----------RGK--VATCQATINSSLC-TGKA---NQDEDSQHTDKKD---EDSRD 203
            |.|||.:           |||  .||..|.:.:... :|.|   ..|:.||...:.:   |:...
Human    32 KKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVS 96

  Fly   204 QGSQYEDSPGMDSQYKDCRDQDSQYEDSHGKDSQYKDCRDQGSQYEDSHGMDSQYEDSRDQDSQY 268
            :|:|: |....:|:.::...|:|:.|:...::||.::...|.|:.|:....:||.|:...|:|:.
Human    97 EGTQH-DPLSQESELEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEV 160

  Fly   269 EDSPGMDSQYKDSRDQDSQYED 290
            |:....:||.::...|:|:.|:
Human   161 EEPLSQESQVEEPLSQESEMEE 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723
VCX3ANP_057463.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..186 39/152 (26%)
VCX_VCY 1..141 CDD:291884 27/109 (25%)
8 X 10 AA tandem repeats of L-S-Q-E-S-[EQ]-V-E-E-P 104..183 20/79 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.