DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and VCX2

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_057462.2 Gene:VCX2 / 51480 HGNCID:18158 Length:139 Species:Homo sapiens


Alignment Length:92 Identity:22/92 - (23%)
Similarity:39/92 - (42%) Gaps:21/92 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 KVKTTAI-----------RGK--VATCQATINS----SLCTGKANQDEDSQHTDKKD---EDSRD 203
            |.|||.:           |||  .||..|.:.:    |........|:.||...:.:   |:...
Human    32 KKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESAPAAPGPSDQPSQELPQHELPPEEPVS 96

  Fly   204 QGSQYEDSPGMDSQYKDCRDQDSQYED 230
            :|:|: |....:|:.::...|:|:.|:
Human    97 EGTQH-DPLSQESEVEEPLSQESEVEE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723
VCX2NP_057462.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..139 22/92 (24%)
VCX_VCY 1..138 CDD:291884 22/92 (24%)
2 X 10 AA tandem repeats of L-S-Q-E-S-[EQ]-V-E-E-P 104..123 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.