DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and ebp-1

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_507526.1 Gene:ebp-1 / 3565059 WormBaseID:WBGene00013344 Length:316 Species:Caenorhabditis elegans


Alignment Length:172 Identity:58/172 - (33%)
Similarity:89/172 - (51%) Gaps:11/172 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NVTVTHNSLVQWSRGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQE 72
            ||..|.:|....||.::|.|.|:.||.:...||||.|||.||.....|:|..|.||:||:.|..|
 Worm     7 NVYTTASSADNLSRHEMLMWVNDCLQAHFTKIEQLHTGAGYCLFTDFLFPDSIQLKKVKWNSRLE 71

  Fly    73 YEYVNNFKELQKAFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHTKDKCAGYDALVAR 137
            .::::|:|.:|..:..:.|.....|:.||||...:||:|..||:..|:.|:...:   ||.:.||
 Worm    72 LDWLSNWKLVQTTWKNLGVEKVIPVDKLIKGKFQDNFEFLQWFKKLFDANYDGHE---YDPMQAR 133

  Fly   138 DHQNIGI-------GSSKLTTKDRFRLVKVK-TTAIRGKVAT 171
            :.:.:..       .|:|..::...|.|..| .|.:|...||
 Worm   134 NGEGLPTEGGPAAGASAKTPSRMPARSVPQKPVTTMRTPAAT 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723 32/82 (39%)
ebp-1NP_507526.1 BIM1 19..308 CDD:227542 54/160 (34%)
CH 19..117 CDD:294029 39/97 (40%)
EB1 258..295 CDD:281288
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166349
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.