DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and CG2955

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_608817.1 Gene:CG2955 / 33622 FlyBaseID:FBgn0031585 Length:565 Species:Drosophila melanogaster


Alignment Length:413 Identity:95/413 - (23%)
Similarity:149/413 - (36%) Gaps:107/413 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SRGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQEYEYVNNFKELQK 84
            ||..||.|.|..|....:.:|:|.|||.||.::|.|.|..|.||||.......||.|.|.|.|||
  Fly    14 SRRRILGWINNNLGTTYVRLEELRTGAEYCRMLHKLQPSAIRLKRVFKEPKSHYECVQNMKLLQK 78

  Fly    85 AFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNH-------TKD---------------- 126
            :..|..|.....:..|:.....|:.:||.||:.|::.||       |:|                
  Fly    79 SLLKQGVEKQIPIQRLVSRGNSESLEFAQWFKAFYDHNHQLLWPEKTEDAPKPLEKFDEKPDSFV 143

  Fly   127 ---KCA-------GYDALVARDHQNIGIGSSKLTTKDRFRLVKVKTTAIRGKVATCQATINSSLC 181
               ||.       ..|:.|:..|.|       .:.|:.....|.|||.                 
  Fly   144 DTGKCRYGARCSHRLDSTVSSRHSN-------QSGKNFENYQKKKTTT----------------- 184

  Fly   182 TGKANQDEDSQHTDKKDEDSRDQ--GSQYEDSPG-----MDSQYKDCRDQ---DSQYEDSHGKDS 236
            ||..:..:...|  :||:.::..  || .||..|     .:..|:..:..   .|::...|.|.|
  Fly   185 TGSNSVGKSENH--RKDDSTKHPLWGS-LEDFDGYTPEVFNKTYRAAKKYKIVKSRFIRKHTKRS 246

  Fly   237 ----QYKDCRDQGSQYEDSHG---------------MDSQYEDSRDQDSQYEDSPGMDSQYKDSR 282
                ..|..|...|:.:.|..               :.|..::.|...:...:.||:...:|.:.
  Fly   247 NKPRNSKTVRIAKSENQKSESAPFIDDPDIVLATEVLASGLDEPRTTQTYMINVPGVKLGFKPNL 311

  Fly   283 DQDSQ-YEDSH---GKD----------SQYKDCRDQGSQYEDSHGMDSQYKDSRDQG----CQYE 329
            .|..: .||.|   .|.          |.:.|..:..:...|.|..::..|.|.::.    .:.:
  Fly   312 FQYPEIIEDYHTILAKKCLLFLDDVHVSFHLDLGELSTLTHDIHRTETDLKKSDEERVSLIAELD 376

  Fly   330 DSHGKDSEDEDSQYEDSQDIHMV 352
            .|..:.|....|.||::..|.::
  Fly   377 SSPDEWSSTWQSTYENALPIDVI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723 33/82 (40%)
CG2955NP_608817.1 CH 14..99 CDD:278723 33/84 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468766
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.