DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and mapre1b

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_005162006.2 Gene:mapre1b / 334728 ZFINID:ZDB-GENE-040426-2256 Length:274 Species:Danio rerio


Alignment Length:135 Identity:60/135 - (44%)
Similarity:86/135 - (63%) Gaps:6/135 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HNVTVTHNSLVQWSRGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQ 71
            ::.:||.::|   ||.|:|.|.||:||.|...||.||:|||||..|.||:|..|.||:|||.:..
Zfish     6 YSTSVTSDNL---SRHDMLAWINESLQMNFTKIELLCSGAAYCQFMDMLFPGCIPLKKVKFGAKL 67

  Fly    72 EYEYVNNFKELQKAFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHTKDKCAGYDALVA 136
            |:||::|||.||.||.|:.|.....|:.|:||...:||::..||:.||:.|:...:   ||.:.|
Zfish    68 EHEYIHNFKILQAAFKKMGVDKIIPVDKLVKGKFQDNFEYVQWFKKFFDANYDGKE---YDPVEA 129

  Fly   137 RDHQN 141
            |..|:
Zfish   130 RQGQD 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723 43/82 (52%)
mapre1bXP_005162006.2 BIM1 16..269 CDD:227542 57/122 (47%)
CH 16..100 CDD:278723 44/83 (53%)
EB1 219..256 CDD:281288
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594782
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.