DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and mapre1a

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_956158.2 Gene:mapre1a / 334135 ZFINID:ZDB-GENE-030131-6067 Length:272 Species:Danio rerio


Alignment Length:140 Identity:64/140 - (45%)
Similarity:89/140 - (63%) Gaps:6/140 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NVTVTHNSLVQWSRGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQE 72
            :.:||..:|   ||.|:|.|.||:||.|...|||||||||||:.|.||:|..:.||:|||.:..|
Zfish     7 STSVTSENL---SRHDMLTWINESLQMNHAKIEQLCTGAAYCHFMDMLFPSCLPLKKVKFQAKLE 68

  Fly    73 YEYVNNFKELQKAFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHTKDKCAGYDALVAR 137
            :||::|||.||.:|.|:.||....|:.|:||...:||:|..||:.||:.|:...:   ||.:.||
Zfish    69 HEYIHNFKLLQASFKKMGVSKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKE---YDPVAAR 130

  Fly   138 DHQNIGIGSS 147
            ..|:|....|
Zfish   131 QGQDIPTNQS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723 44/82 (54%)
mapre1aNP_956158.2 CH 16..114 CDD:278723 51/97 (53%)
EB1 217..254 CDD:281288
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594778
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.