DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and CG32371

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_729295.1 Gene:CG32371 / 317999 FlyBaseID:FBgn0052371 Length:294 Species:Drosophila melanogaster


Alignment Length:258 Identity:82/258 - (31%)
Similarity:126/258 - (48%) Gaps:41/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NVTVTHNSLVQWSRGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQE 72
            ||..|:......||.::|.|.|.||:.....:|:||||||||.||.:|:.:.|.::||||.:|.|
  Fly    11 NVRYTNKLSSNSSRAEMLSWVNNTLKSQFFKVEELCTGAAYCQLMDILFARSIPMQRVKFRTNVE 75

  Fly    73 YEYVNNFKELQKAFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHTKDKCAGYDALVAR 137
            |||:.|||.||..|||..|.....::.|:||...:||:|..|||.||:.|:...:   ||.::||
  Fly    76 YEYIQNFKLLQGCFNKFVVDKIIPIDRLVKGRYQDNFEFLQWFRKFFDANYESRE---YDPVIAR 137

  Fly   138 DHQNIGIGSSKLTTKDRFRLVKVKTTAIRGKVATCQATINSSLCTGKANQDEDSQHTDKKDEDSR 202
            :...:|:||..:..|.|                   .::|.|....|.. :|.|..||:...:.:
  Fly   138 NGAMLGLGSPPMEAKLR-------------------KSVNKSNPQTKPT-EESSAQTDRATTEPK 182

  Fly   203 DQGSQYEDSPGMDSQYKDCRDQDSQYE------DSHGKDSQYKDCRDQGSQYE------DSHG 253
            :|  .|:.    :|:.|...:..:|.:      ::...:||.|......:|.|      ||.|
  Fly   183 NQ--VYKS----NSENKTIEEASAQTDLAITEPENQVHESQTKTTEKASAQTEKATTEPDSEG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723 39/82 (48%)
CG32371NP_729295.1 CH 22..121 CDD:278723 47/98 (48%)
BIM1 23..>269 CDD:227542 79/246 (32%)
EB1 255..293 CDD:281288
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468775
Domainoid 1 1.000 89 1.000 Domainoid score I2088
eggNOG 1 0.900 - - E1_COG5217
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100079at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.