DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and dnmt3bb.2

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_571461.1 Gene:dnmt3bb.2 / 30659 ZFINID:ZDB-GENE-990712-11 Length:1448 Species:Danio rerio


Alignment Length:217 Identity:54/217 - (24%)
Similarity:100/217 - (46%) Gaps:35/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQEYEYVNNFKELQKAFN 87
            ::|||.|..||.....:|..|:|||:|.||.::.|..|::.:|.|.:.:..:.:||:..||:||:
Zfish    16 ELLDWLNGLLQATFSQVEDTCSGAAFCQLMDIIQPGSIDVTKVNFTAEENLDILNNYNLLQEAFS 80

  Fly    88 KVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHTKDKCAGYDALVARDHQNIGIGSSKLTTK 152
            |..:....|:..|:.|..:.......||:..::.|..|.||....|.:  ..:.:.:.||:    
Zfish    81 KAQIQKELELTLLVNGDIMTTCDLLTWFKDMYDHNFAKQKCNPQVAFI--KPEVVSLKSSR---- 139

  Fly   153 DRFRLVKVKTTAIRGKVATCQATINSSLCTGKANQDEDSQHTDKKDEDS----------RDQGSQ 207
             .|..::             :..::|...|.:.:.::.:||.:|..::|          |..||.
Zfish   140 -EFETIE-------------KENVSSLYNTEETSSNQKTQHVEKTSQESVSWSPLTSFIRKYGSS 190

  Fly   208 Y---EDSPGMDSQYKDCRDQDS 226
            .   ::|..::|  |||..|.|
Zfish   191 TLTDDESNNVNS--KDCPGQKS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723 27/79 (34%)
dnmt3bb.2NP_571461.1 CH 16..>81 CDD:278723 24/64 (38%)
Dnmt3b_related 790..873 CDD:99896
PHD_SF 1020..1139 CDD:304600
Dcm 1163..>1325 CDD:223348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.