DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and MAPRE1

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_036457.1 Gene:MAPRE1 / 22919 HGNCID:6890 Length:268 Species:Homo sapiens


Alignment Length:142 Identity:64/142 - (45%)
Similarity:88/142 - (61%) Gaps:8/142 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HNVTVTHNSLVQWSRGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQ 71
            ::.:||.::|   ||.|:|.|.||:||.||..|||||:|||||..|.||:|..|.||:|||.:..
Human     6 YSTSVTSDNL---SRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKL 67

  Fly    72 EYEYVNNFKELQKAFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHT-KDKCAGYDALV 135
            |:||:.|||.||..|.::.|.....|:.|:||...:||:|..||:.||:.|:. ||    ||.:.
Human    68 EHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKD----YDPVA 128

  Fly   136 ARDHQNIGIGSS 147
            ||..|...:..|
Human   129 ARQGQETAVAPS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723 43/82 (52%)
MAPRE1NP_036457.1 BIM1 16..257 CDD:227542 61/129 (47%)
Interaction with MTUS2/TIP150. /evidence=ECO:0000269|PubMed:19543227 124..268 6/17 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..187
Interaction with CDK5RAP2. /evidence=ECO:0000269|PubMed:19553473 185..268
DCTN1-binding 208..268
APC-binding 220..242
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158827
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.