DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and Mapre2

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_694698.3 Gene:Mapre2 / 212307 MGIID:106271 Length:326 Species:Mus musculus


Alignment Length:301 Identity:86/301 - (28%)
Similarity:137/301 - (45%) Gaps:43/301 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VTVTHNSLVQ--WSRGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQ 71
            |.|...|:.|  .||.||:.|.|:.:..|...:||||:|||||..|.||:|..|:||:|||.:..
Mouse    45 VNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKL 109

  Fly    72 EYEYVNNFKELQKAFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHTKDKCAGYDALVA 136
            |:||::|||.||.:|.::||.....|..|:||...:|..|..||:.|::.|:...:   ||.:.|
Mouse   110 EHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKE---YDPVEA 171

  Fly   137 RDHQNIGIGSSKLTTKDR----FRLVKV-----KTTAIRGKVATCQATINSSLCTGKANQDEDSQ 192
            |.      |...:...|.    |.|.|.     ..||...|.:......::......|.:...|.
Mouse   172 RQ------GQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPASKPGSTPSRPSSAKRASSSG 230

  Fly   193 HTDKKDEDSRDQGSQYEDS--------PGMDSQYKDCRDQDSQYEDSHGKDSQYK-DCRDQGSQY 248
            ...:.|:|...|..|..:.        .|::      :::|..:    ||..:.: .|::.|.:.
Mouse   231 SASRSDKDLETQVIQLNEQVHSLKLALEGVE------KERDFYF----GKLREIELLCQEHGQEN 285

  Fly   249 ED--SHGMDSQYEDSRDQDSQYEDSPGMDSQYKDSRDQDSQ 287
            :|  ...|:..|. |.:|:.|.|: |..:.|..|.:.|..:
Mouse   286 DDLVQRLMEVLYA-SDEQEGQTEE-PEAEEQAHDQQPQQQE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723 39/82 (48%)
Mapre2NP_694698.3 EB1 58..312 CDD:331377 79/274 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..239 13/74 (18%)
DCTN1-binding. /evidence=ECO:0000250 186..326 29/151 (19%)
APC-binding. /evidence=ECO:0000250 258..301 10/53 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..326 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849206
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.