powered by:
Protein Alignment CG15306 and ebp-3
DIOPT Version :9
Sequence 1: | NP_001259403.1 |
Gene: | CG15306 / 31961 |
FlyBaseID: | FBgn0030191 |
Length: | 357 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_507528.1 |
Gene: | ebp-3 / 180181 |
WormBaseID: | WBGene00007062 |
Length: | 187 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 11/65 - (16%) |
Similarity: | 27/65 - (41%) |
Gaps: | 15/65 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 FKELQKAFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHTKDKCAGYDALVARDHQNIG 143
|.:|::...:|...|....|.:....:..:| :|:...|.: ::.:|:::||
Worm 104 FNKLKEELEEVTRQLTESDNVIASLEKERDF--------YFSKLRTIE-------VICQDNESIG 153
Fly 144 143
Worm 154 153
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15306 | NP_001259403.1 |
CH |
20..103 |
CDD:278723 |
5/23 (22%) |
ebp-3 | NP_507528.1 |
EB1 |
128..166 |
CDD:367431 |
6/41 (15%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160166347 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5217 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1237523at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10623 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
6 | 5.810 |
|
Return to query results.
Submit another query.