DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and ebp-3

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_507528.1 Gene:ebp-3 / 180181 WormBaseID:WBGene00007062 Length:187 Species:Caenorhabditis elegans


Alignment Length:65 Identity:11/65 - (16%)
Similarity:27/65 - (41%) Gaps:15/65 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 FKELQKAFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHTKDKCAGYDALVARDHQNIG 143
            |.:|::...:|...|....|.:....:..:|        :|:...|.:       ::.:|:::||
 Worm   104 FNKLKEELEEVTRQLTESDNVIASLEKERDF--------YFSKLRTIE-------VICQDNESIG 153

  Fly   144  143
             Worm   154  153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723 5/23 (22%)
ebp-3NP_507528.1 EB1 128..166 CDD:367431 6/41 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166347
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.