DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and Mapre1

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_612518.2 Gene:Mapre1 / 114764 RGDID:621781 Length:268 Species:Rattus norvegicus


Alignment Length:141 Identity:62/141 - (43%)
Similarity:87/141 - (61%) Gaps:6/141 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HNVTVTHNSLVQWSRGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQ 71
            ::.:||.::|   ||.|:|.|.||:||.||..|||||:|||||..|.||:|..|.||:|||.:..
  Rat     6 YSTSVTSDNL---SRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKL 67

  Fly    72 EYEYVNNFKELQKAFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHTKDKCAGYDALVA 136
            |:||:.|||.||..|.::.|.....|:.|:||...:||:|..||:.||:.|:...:   ||.:.|
  Rat    68 EHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKE---YDPVAA 129

  Fly   137 RDHQNIGIGSS 147
            |..|...:..|
  Rat   130 RQGQETAVAPS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723 43/82 (52%)
Mapre1NP_612518.2 BIM1 16..257 CDD:227542 59/128 (46%)
Interaction with MTUS2/TIP150. /evidence=ECO:0000250 124..268 6/17 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..191
DCTN1-binding. /evidence=ECO:0000250 208..268
APC-binding. /evidence=ECO:0000250 220..242
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352827
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.