DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and Mapre3

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_579928.1 Gene:Mapre3 / 100732 MGIID:2140967 Length:281 Species:Mus musculus


Alignment Length:301 Identity:85/301 - (28%)
Similarity:140/301 - (46%) Gaps:66/301 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HNVTVTHNSLVQWSRGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQ 71
            ::.:||..:|   ||.|:|.|.|::|..|...|||||:|||||..|.||:|..::|::|||.:..
Mouse     6 YSTSVTSENL---SRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKL 67

  Fly    72 EYEYVNNFKELQKAFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHT-KDKCAGYDALV 135
            |:||::|||.||.||.|:.|.....|..|:||...:||:|..||:.||:.|:. ||    |:.|:
Mouse    68 EHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKD----YNPLL 128

  Fly   136 ARDHQNIG---IGSSKLTTKDRFRLVKVKTTAIRGKVATCQATINSSLCTGKANQDEDSQHTD-- 195
            ||..|::.   ....::..|.:    |:..||:..:.:.          ||..|.....:.::  
Mouse   129 ARQGQDVAPPPNPGDQIFNKSK----KLIGTAVPQRTSP----------TGPKNMQTSGRLSNVA 179

  Fly   196 -----KKDEDSRDQGSQYEDSP--GMDSQYKDC--------RDQDSQYEDSHGKDSQYKD----C 241
                 :|:..|...|....|:.  .::.|..|.        :::|..:       |:.:|    |
Mouse   180 PPCILRKNPPSARNGGHEADAQILELNQQLLDLKLTVDGLEKERDFYF-------SKLRDIELIC 237

  Fly   242 RDQGSQ------------YEDSHGMDSQYEDSRDQDSQYED 270
            ::..|:            |....|. :..||...::.|.||
Mouse   238 QEHESENSPVISGIIGILYATEEGF-APPEDDEIEEHQQED 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723 40/82 (49%)
Mapre3NP_579928.1 BIM1 16..279 CDD:227542 82/288 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..181 3/33 (9%)
DCTN1-binding. /evidence=ECO:0000250 217..281 12/69 (17%)
APC-binding. /evidence=ECO:0000250 217..260 6/49 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..281 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849207
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.