DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15306 and mapre2

DIOPT Version :9

Sequence 1:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001120403.1 Gene:mapre2 / 100145479 XenbaseID:XB-GENE-6455519 Length:326 Species:Xenopus tropicalis


Alignment Length:305 Identity:90/305 - (29%)
Similarity:139/305 - (45%) Gaps:48/305 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VTVTHNSLVQ--WSRGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQ 71
            |.|...|:.|  .||.||:.|.|:.:..|.|.:||||:|||||..|.||:|..|:||:|||.:..
 Frog    45 VNVYSTSITQETMSRHDIIAWVNDIVCLNYIKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKL 109

  Fly    72 EYEYVNNFKELQKAFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHTKDKCAGYDALVA 136
            |:||::|||.||.:|.::||.....|..|:||...:|..|..||:.||:.|:...:   ||.:.|
 Frog   110 EHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFFDANYDGKE---YDPMEA 171

  Fly   137 RDHQNIGIGSSKLTTKDR----FRLVKVKTTAIRGKVATCQATINSSLCTGKANQDEDSQ----- 192
            |.      |...|...|.    |.|.|....|   ...|..|..:|.:....:.....|.     
 Frog   172 RQ------GQDALPPPDPGEQIFNLPKKPHHA---NSPTAGAAKSSPIAKPGSTSSRPSSAKKAA 227

  Fly   193 --HTDKKDEDSRDQGSQYEDS--------PGMDSQYKDCRDQDSQYEDSHGKDSQYK-DCRDQGS 246
              .:.|.|:|...|.||..:.        .|::      :::|..:    ||..:.: .|::.|.
 Frog   228 PTPSVKSDKDLETQVSQLNEQVHSLKIALEGVE------KERDFYF----GKLREIELLCQEHGQ 282

  Fly   247 QYED--SHGMDSQYEDSRDQDSQYEDSPGMDSQY-KDSRDQDSQY 288
            :.:|  ...||..| .|.:|:|..:...|.:..: ::...|..:|
 Frog   283 EGDDLVQRLMDILY-SSEEQESHTDQQEGEEQDHGQEEAQQQEEY 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15306NP_001259403.1 CH 20..103 CDD:278723 40/82 (49%)
mapre2NP_001120403.1 BIM1 58..314 CDD:227542 84/278 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.