DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gip and ycjR

DIOPT Version :9

Sequence 1:NP_511106.1 Gene:Gip / 31960 FlyBaseID:FBgn0011770 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_415830.2 Gene:ycjR / 947427 ECOCYCID:G6652 Length:262 Species:Escherichia coli


Alignment Length:285 Identity:64/285 - (22%)
Similarity:123/285 - (43%) Gaps:56/285 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKFAANLNFLFTERATSIAERIRLAHQNGFRAVEIPYPEGE-----TSDVVSAVKETGVVVSLVN 62
            :|........|.|   :|.|:.|...:.||...||   :|:     ..:|.:|:||||:.|:...
E. coli     1 MKIGTQNQAFFPE---NILEKFRYIKEMGFDGFEI---DGKLLVNNIEEVKAAIKETGLPVTTAC 59

  Fly    63 LAFDK--SD--DQLRFGSTSVPGSEKLFRSQLDATIDFARQVNCGKIHLTAGLFKGGQESDYT-- 121
            ..:|.  .|  ::.|....          .|::..::...:|. ||     |:........:|  
E. coli    60 GGYDGWIGDFIEERRLNGL----------KQIERILEALAEVG-GK-----GIVVPAAWGMFTFR 108

  Fly   122 -------KTYTANLKIAADSLRASKMIGV-------IEPINKYAVPGYYMNSYSKAAGILADVAA 172
                   ::...:.|:.:||||..:.:..       :||:|:|  ..:.:|:.:.|...:.:...
E. coli   109 LPPMTSPRSLDGDRKMVSDSLRVLEQVAARTGTVVYLEPLNRY--QDHMINTLADARRYIVENDL 171

  Fly   173 DNIQLLADLYHLQHLHGNVSKTLEEYKALIGHFQIAQVPHRHEPDVSGELDYGFVFKALQEFGYD 237
            .::|::.|.||:.....|:::.|.:.:.|:||..||. .||::|. ||.||:..:|:.|:...|.
E. coli   172 KHVQIIGDFYHMNIEEDNLAQALHDNRDLLGHVHIAD-NHRYQPG-SGTLDFHALFEQLRADNYQ 234

  Fly   238 GWIGCEYK-----PKTTTVEGLGWV 257
            |::..|.:     |.....:.|.|:
E. coli   235 GYVVYEGRIRAEDPAQAYRDSLAWL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GipNP_511106.1 OH-pyruv-isom 4..256 CDD:163190 63/281 (22%)
AP_endonuc_2 24..222 CDD:279585 49/222 (22%)
ycjRNP_415830.2 YcjR 1..262 CDD:224007 64/285 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
21.910

Return to query results.
Submit another query.