DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gip and hyi

DIOPT Version :9

Sequence 1:NP_511106.1 Gene:Gip / 31960 FlyBaseID:FBgn0011770 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_956628.1 Gene:hyi / 393305 ZFINID:ZDB-GENE-040426-1273 Length:253 Species:Danio rerio


Alignment Length:244 Identity:97/244 - (39%)
Similarity:142/244 - (58%) Gaps:10/244 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IRLAHQNGFRAVEIPY-PEGETSDVVSAVKETGVVVSLVNL-AFDKSDDQLRFGSTSVPGSEKLF 86
            :|.|...||||||..: ...:..::.:|.:|||:...|:|. ..|.|...|  |..:|||.|:.|
Zfish     1 MRAAASAGFRAVEAAWLYNTDLKELKTAKEETGLEFVLINTPPGDASAGDL--GLAAVPGREQEF 63

  Fly    87 RSQLDATIDFARQVNCGKIHLTAGLFKGGQES-----DYTKTYTANLKIAADSLRASKMIGVIEP 146
            |..||..:.:|:.::|.:|||.||....|.|.     ....|:..|||.||..|....::|:|||
Zfish    64 RQGLDLAVQYAKALDCTRIHLMAGRVPAGSERCALALQMEDTFVHNLKHAAGVLDKEGLLGLIEP 128

  Fly   147 IN-KYAVPGYYMNSYSKAAGILADVAADNIQLLADLYHLQHLHGNVSKTLEEYKALIGHFQIAQV 210
            || :...|.|:::|..:||.||..|...:|::..|::|.|.:.||::..:..|..:.||.|||||
Zfish   129 INSRITDPRYFLHSPHQAAEILQRVDHPSIKMQMDIFHWQIMDGNLTHNIRRYLPMTGHIQIAQV 193

  Fly   211 PHRHEPDVSGELDYGFVFKALQEFGYDGWIGCEYKPKTTTVEGLGWVSK 259
            |.|||||..|||::.|:|:.|:|..|.|:|||||||:.:|..||.|:.|
Zfish   194 PDRHEPDSPGELNFSFIFRLLEELDYQGFIGCEYKPQGSTEAGLEWLRK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GipNP_511106.1 OH-pyruv-isom 4..256 CDD:163190 95/239 (40%)
AP_endonuc_2 24..222 CDD:279585 77/205 (38%)
hyiNP_956628.1 Hyi 2..243 CDD:226149 97/243 (40%)
AP_endonuc_2 2..204 CDD:279585 76/203 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588116
Domainoid 1 1.000 107 1.000 Domainoid score I6482
eggNOG 1 0.900 - - E1_COG3622
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12824
Inparanoid 1 1.050 183 1.000 Inparanoid score I3956
OMA 1 1.010 - - QHG52228
OrthoDB 1 1.010 - - D1440394at2759
OrthoFinder 1 1.000 - - FOG0005694
OrthoInspector 1 1.000 - - oto39925
orthoMCL 1 0.900 - - OOG6_106707
Panther 1 1.100 - - LDO PTHR43489
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6107
SonicParanoid 1 1.000 - - X4089
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.