DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gip and hyi

DIOPT Version :9

Sequence 1:NP_511106.1 Gene:Gip / 31960 FlyBaseID:FBgn0011770 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_012816017.1 Gene:hyi / 100135187 XenbaseID:XB-GENE-5847279 Length:284 Species:Xenopus tropicalis


Alignment Length:210 Identity:87/210 - (41%)
Similarity:132/210 - (62%) Gaps:7/210 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VVSLVNLA-FDKSDDQLRFGSTSVPGSEKLFRSQLDATIDFARQVNCGKIHLTA-----GLFKGG 115
            ::|..|:| |..:.:....|..:|||.:..||:.|:..:.:|..:.|.:||:.|     ||.:..
 Frog    63 LLSGCNIAKFPGNIEAGELGLAAVPGRQDEFRTGLNEAVRWASDLGCDRIHIMAGRVPLGLERQN 127

  Fly   116 QESDYTKTYTANLKIAADSLRASKMIGVIEPINK-YAVPGYYMNSYSKAAGILADVAADNIQLLA 179
            .|.:..:|:..||:.|||.|..:.|:|::||||. .:.|.|::|:...||.||..|...|::|..
 Frog   128 IEEEMEETFIENLQYAADILAQAGMVGLLEPINSLISEPRYFLNTPQHAASILQKVKRPNLKLQM 192

  Fly   180 DLYHLQHLHGNVSKTLEEYKALIGHFQIAQVPHRHEPDVSGELDYGFVFKALQEFGYDGWIGCEY 244
            ||||.|.:.||:::.::.|..||||.||||||||:|||..|||::.::|..|||.||.|::||||
 Frog   193 DLYHWQIMGGNLTQNIKTYFPLIGHVQIAQVPHRNEPDSPGELNFMYLFDLLQELGYQGYVGCEY 257

  Fly   245 KPKTTTVEGLGWVSK 259
            ||:..|.:||||:.|
 Frog   258 KPQGDTAKGLGWMKK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GipNP_511106.1 OH-pyruv-isom 4..256 CDD:163190 84/205 (41%)
AP_endonuc_2 24..222 CDD:279585 66/171 (39%)
hyiXP_012816017.1 AP_endonuc_2 <72..235 CDD:279585 63/162 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I5981
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12824
Inparanoid 1 1.050 186 1.000 Inparanoid score I3806
OMA 1 1.010 - - QHG52228
OrthoDB 1 1.010 - - D1440394at2759
OrthoFinder 1 1.000 - - FOG0005694
OrthoInspector 1 1.000 - - oto102402
Panther 1 1.100 - - LDO PTHR43489
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6107
SonicParanoid 1 1.000 - - X4089
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.