DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Man-Ia and EDEM2

DIOPT Version :9

Sequence 1:NP_727408.2 Gene:alpha-Man-Ia / 31957 FlyBaseID:FBgn0259170 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_060687.2 Gene:EDEM2 / 55741 HGNCID:15877 Length:578 Species:Homo sapiens


Alignment Length:494 Identity:159/494 - (32%)
Similarity:227/494 - (45%) Gaps:98/494 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 RAHVKQMMEHAWHNYKLYAWGKNELRPLSQRPHSASIFGSYDLGATIVDGLDTLYIMGLEKEYRE 282
            |..||.|..||:.:|...|:..:|||||:...|..  :||:.|  |::|.||||.|:|...|::.
Human    36 RERVKAMFYHAYDSYLENAFPFDELRPLTCDGHDT--WGSFSL--TLIDALDTLLILGNVSEFQR 96

  Fly   283 GRDWIERKFSLDNISAELSVFETNIRFVGGMLTLYAFT-------------GDPLYKEKAQHVAD 334
            ..:.::.....| |....||||||||.|||:|:.:..:             ..||.: .|:..|.
Human    97 VVEVLQDSVDFD-IDVNASVFETNIRVVGGLLSAHLLSKKAGVEVEAGWPCSGPLLR-MAEEAAR 159

  Fly   335 KLLPAFQTPTGIPYALVNTKTGVAKNYGWASGGSSILSEFGTLHLEFAYLSDITGNPLYRERVQT 399
            |||||||||||:||..||...||  |.|  ....:..:..||..:|||.||.:||:|::.:..:.
Human   160 KLLPAFQTPTGMPYGTVNLLHGV--NPG--ETPVTCTAGIGTFIVEFATLSSLTGDPVFEDVARV 220

  Fly   400 IRQVLKEIEKPKGLYPNFLNPKTGKWGQLHMSLGALGDSYYEYLLKA--WLQSGQTDEEAREMFD 462
            ....|.|.....||..|.::..||||......:||..|||:|||:|.  .||    |::...||.
Human   221 ALMRLWESRSDIGLVGNHIDVLTGKWVAQDAGIGAGVDSYFEYLVKGAILLQ----DKKLMAMFL 281

  Fly   463 EAMLAILD-----------KMVRTSPGGLTYVSDLKFDRLEHKMDHLACFSGGLFALGAATRQND 516
            |...||.:           :|.:.:      ||...|..||.....|....|.:           
Human   282 EYNKAIRNYTRFDDWYLWVQMYKGT------VSMPVFQSLEAYWPGLQSLIGDI----------- 329

  Fly   517 YTDKYMEVGKGITNTCHESYIRAPTQLG--PEAFRFSE--AVEARALRSQEKYYILRPETFESYF 577
              |..|..        ..:|.....|.|  ||.:...:  .||.|      :.|.||||..||..
Human   330 --DNAMRT--------FLNYYTVWKQFGGLPEFYNIPQGYTVEKR------EGYPLRPELIESAM 378

  Fly   578 VLWRLTHDQKYRDWGWEAVLALEKHCRTAHGYCGLRNVYQQEPQKDDVQQSFFLAETLKYLYLLF 642
            .|:|.|.|....:.|.:||.::||..:...|:..::::  ::.:.|:..:|||||||:|||||||
Human   379 YLYRATGDPTLLELGRDAVESIEKISKVECGFATIKDL--RDHKLDNRMESFFLAETVKYLYLLF 441

  Fly   643 S------------DDSVLPLDE-------WVFNTEAHPL 662
            .            |..:.|..|       ::|||||||:
Human   442 DPTNFIHNNGSTFDAVITPYGECILGAGGYIFNTEAHPI 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Man-IaNP_727408.2 Glyco_hydro_47 224..664 CDD:279825 156/488 (32%)
EDEM2NP_060687.2 Glyco_hydro_47 42..480 CDD:279825 155/486 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 517..557
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149703
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.