DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hk and AKR1C3

DIOPT Version :10

Sequence 1:NP_001259401.1 Gene:Hk / 31955 FlyBaseID:FBgn0263220 Length:887 Species:Drosophila melanogaster
Sequence 2:NP_003730.4 Gene:AKR1C3 / 8644 HGNCID:386 Length:323 Species:Homo sapiens


Alignment Length:67 Identity:20/67 - (29%)
Similarity:27/67 - (40%) Gaps:9/67 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SESPTAIVMPPPYMDPANSQAKKQRQSFRQESIRKLKVCEHCGALPHAQIRN-LPEEQVFTWPAA 65
            ||....::..||...||.|  |....|..||..|.:      .:|...:::| ||.......|||
Human   164 SEVIHGVLHSPPSPFPAPS--KPSATSATQELDRLM------ASLSDFRVQNHLPASGPPQPPAA 220

  Fly    66 RP 67
            .|
Human   221 SP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HkNP_001259401.1 AKR_AKR6B1 203..535 CDD:381368
AKR1C3NP_003730.4 AKR_AKR1C1-35 6..306 CDD:381334 20/67 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.