DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hk and AKR7A2

DIOPT Version :9

Sequence 1:NP_001259401.1 Gene:Hk / 31955 FlyBaseID:FBgn0263220 Length:887 Species:Drosophila melanogaster
Sequence 2:NP_003680.2 Gene:AKR7A2 / 8574 HGNCID:389 Length:359 Species:Homo sapiens


Alignment Length:354 Identity:85/354 - (24%)
Similarity:138/354 - (38%) Gaps:76/354 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 RISNVGLGTWPVFSPGVSDDQAEAILKLAIESGINLFD----ISEAHSETEIGKILQRAGWKRTA 274
            |:::| |||..: ...:....:.|.::..:|.|....|    .|:..|||.:|.:....|.....
Human    37 RVASV-LGTMEM-GRRMDAPASAAAVRAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCR 99

  Fly   275 YVITTKVY-WSTKSEERGLSRKHIIECVRASLQRLQLQYIDIVIIHKADPMCPM-EVVRAMSYVI 337
            ..|.||.. |..||    |....:...:..||:|||...:|:..:|..|...|: |.:.|...:.
Human   100 VKIATKANPWDGKS----LKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLH 160

  Fly   338 QQGWAMYWGTARWSQVEIMEAYTNCRQFNCITPIVEQSEYHMFCRE-KCELYLPEMYNKIGVGLM 401
            |:|..:..|.:.::..|:.|..|.|:....|.|.|.|..|:...|: :.||:  ......|:...
Human   161 QEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELF--PCLRHFGLRFY 223

  Fly   402 AWGPLSMAL------SDTQNGDKLFLPKGSFKTKSFSWTEDEINRNAALSPQGSWGKDRIDEGRR 460
            |:.||:..|      .:.::|.:   |.|.|...  ||.|...||        .|.:       .
Human   224 AYNPLAGGLLTGKYKYEDKDGKQ---PVGRFFGN--SWAETYRNR--------FWKE-------H 268

  Fly   461 HCDRLRDLAALAEK-----LGCSP---TQLSIAWSLKHEPVQ-----CLLLGATSAEQLHQSLQS 512
            |.:.:    ||.||     .|.|.   |..::.|...|..:|     .::||.:|.|||.|:|.:
Human   269 HFEAI----ALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAA 329

  Fly   513 LQLLPRLSSSVMLELERILENKPVRPPMI 541
                              .|..|:.|.::
Human   330 ------------------TEEGPLEPAVV 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HkNP_001259401.1 Kv_beta 205..531 CDD:213602 82/342 (24%)
Aldo_ket_red 218..531 CDD:278668 81/338 (24%)
AKR7A2NP_003680.2 Aldo_ket_red 26..346 CDD:119408 85/354 (24%)
Tas 42..355 CDD:223739 83/348 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158415
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.