DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hk and YPR127W

DIOPT Version :9

Sequence 1:NP_001259401.1 Gene:Hk / 31955 FlyBaseID:FBgn0263220 Length:887 Species:Drosophila melanogaster
Sequence 2:NP_015452.1 Gene:YPR127W / 856245 SGDID:S000006331 Length:345 Species:Saccharomyces cerevisiae


Alignment Length:163 Identity:31/163 - (19%)
Similarity:72/163 - (44%) Gaps:15/163 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 RGLSRKHIIECVRASLQRLQLQYIDIVIIHKAD-PMC------PMEVVRAMSYVIQQGWAMYWGT 347
            || |...:::.|:.|:..:. .||||..:.:.| .:|      |.|...|::.:|.:|.......
Yeast   100 RG-SHDDVVQSVKNSVSAIG-GYIDIFEVARIDTSLCTKGEVYPYESFEALAEMISEGVIGGISL 162

  Fly   348 ARWSQVEIMEAYTNCRQF-NCITPIVEQSEYHMFCREKCELYLPEMYNKIGVGLMAWGPLSMALS 411
            :..::.:|...:.:..:| .|:     :.|..:|..:.....:.:...::|:.::.:.||...|.
Yeast   163 SEVNEEQIRAIHKDWGKFLTCV-----EVELSLFSNDILHNGIAKTCAELGLSIICYSPLGRGLL 222

  Fly   412 DTQNGDKLFLPKGSFKTKSFSWTEDEINRNAAL 444
            ..|......:|:|.|:.....::::.:.:|..|
Yeast   223 TGQLKSNADIPEGDFRKSLKRFSDESLKKNLTL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HkNP_001259401.1 Kv_beta 205..531 CDD:213602 31/163 (19%)
Aldo_ket_red 218..531 CDD:278668 31/163 (19%)
YPR127WNP_015452.1 AKR_AKR8A1-2 8..329 CDD:381303 31/163 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.