DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hk and AAD15

DIOPT Version :10

Sequence 1:NP_001259401.1 Gene:Hk / 31955 FlyBaseID:FBgn0263220 Length:887 Species:Drosophila melanogaster
Sequence 2:NP_014477.1 Gene:AAD15 / 853999 SGDID:S000005525 Length:143 Species:Saccharomyces cerevisiae


Alignment Length:79 Identity:21/79 - (26%)
Similarity:29/79 - (36%) Gaps:15/79 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   777 HSPSFLSPYSGVGGGAGSLQLPSNDGGTIRRSSTSDIVNCRRGGGAGGSGGGAASAQDSRRPSTS 841
            |....|:|:..:|||              |..|...:...|:.|....|..| ||.|.......|
Yeast     4 HFGMALAPWDVMGGG--------------RFQSKKAMEERRKNGECIRSFVG-ASEQTDAEIKIS 53

  Fly   842 DLLRKARERKGSEA 855
            :.|.|..|..|:|:
Yeast    54 EALAKVAEEHGTES 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HkNP_001259401.1 AKR_AKR6B1 203..535 CDD:381368
AAD15NP_014477.1 AKR_SF <1..115 CDD:444925 21/79 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.