DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hk and AAD15

DIOPT Version :9

Sequence 1:NP_001259401.1 Gene:Hk / 31955 FlyBaseID:FBgn0263220 Length:887 Species:Drosophila melanogaster
Sequence 2:NP_014477.1 Gene:AAD15 / 853999 SGDID:S000005525 Length:143 Species:Saccharomyces cerevisiae


Alignment Length:79 Identity:21/79 - (26%)
Similarity:29/79 - (36%) Gaps:15/79 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   777 HSPSFLSPYSGVGGGAGSLQLPSNDGGTIRRSSTSDIVNCRRGGGAGGSGGGAASAQDSRRPSTS 841
            |....|:|:..:|||              |..|...:...|:.|....|..| ||.|.......|
Yeast     4 HFGMALAPWDVMGGG--------------RFQSKKAMEERRKNGECIRSFVG-ASEQTDAEIKIS 53

  Fly   842 DLLRKARERKGSEA 855
            :.|.|..|..|:|:
Yeast    54 EALAKVAEEHGTES 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HkNP_001259401.1 Kv_beta 205..531 CDD:213602
Aldo_ket_red 218..531 CDD:278668
AAD15NP_014477.1 AKR_SF <1..115 CDD:412396 21/79 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345905
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.