DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hk and KAB1

DIOPT Version :9

Sequence 1:NP_001259401.1 Gene:Hk / 31955 FlyBaseID:FBgn0263220 Length:887 Species:Drosophila melanogaster
Sequence 2:NP_171963.1 Gene:KAB1 / 839450 AraportID:AT1G04690 Length:328 Species:Arabidopsis thaliana


Alignment Length:343 Identity:119/343 - (34%)
Similarity:204/343 - (59%) Gaps:26/343 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 LRYKNLGKSGLRISNVGLGTWPVFSPGVSDDQAEAILKLAIESGINLFDISEAH----SETEIGK 263
            ::|||||||||::|.:..|.|..|...:...:|::||:...:.|:|.||.:|.:    :|..:|:
plant     1 MQYKNLGKSGLKVSTLSFGAWVTFGNQLDVKEAKSILQCCRDHGVNFFDNAEVYANGRAEEIMGQ 65

  Fly   264 ILQRAGWKRTAYVITTKVYWSTKS-EERGLSRKHIIECVRASLQRLQLQYIDIVIIHKADPMCPM 327
            .::..||:|:..||:||::|.... .::|||||||:|..:|||:||.:.|:|::..|:.|...|:
plant    66 AIRELGWRRSDIVISTKIFWGGPGPNDKGLSRKHIVEGTKASLKRLDMDYVDVLYCHRPDASTPI 130

  Fly   328 -EVVRAMSYVIQQGWAMYWGTARWSQVEIMEAYTNCRQFNCITPIVEQSEYHMFCREKCELYLPE 391
             |.||||:|||.:|||.||||:.||..:|.||:....:.:.:.|||||.||:||.|.|.|.....
plant   131 EETVRAMNYVIDKGWAFYWGTSEWSAQQITEAWGAADRLDLVGPIVEQPEYNMFARHKVETEFLP 195

  Fly   392 MYNKIGVGLMAWGPLSMALSDTQNGDKLFLPKGS-FKTKSFSWTEDEINRNAALSPQGSWGKDRI 455
            :|...|:||..|.||:..:. |...:|..:|..| |..:::        :|.|       .:..:
plant   196 LYTNHGIGLTTWSPLASGVL-TGKYNKGAIPSDSRFALENY--------KNLA-------NRSLV 244

  Fly   456 DEGRRHCDRLRDLAALAEKLGCSPTQLSIAWSLKHEPVQCLLLGATSAEQLHQSLQSLQLLPRLS 520
            |:..|   ::..|..:|::||.:..||:|||...:..|..::.|||...|:.::::::.::|.|:
plant   245 DDVLR---KVSGLKPIADELGVTLAQLAIAWCASNPNVSSVITGATRESQIQENMKAVDVIPLLT 306

  Fly   521 SSVMLELERILENKPVRP 538
            ..|:.::|:::::||.||
plant   307 PIVLDKIEQVIQSKPKRP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HkNP_001259401.1 Kv_beta 205..531 CDD:213602 115/332 (35%)
Aldo_ket_red 218..531 CDD:278668 105/319 (33%)
KAB1NP_171963.1 AKR_AKR6C1_2 1..316 CDD:381369 115/333 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 190 1.000 Domainoid score I948
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H56491
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000530
OrthoInspector 1 1.000 - - oto3390
orthoMCL 1 0.900 - - OOG6_100387
Panther 1 1.100 - - LDO PTHR43150
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X715
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.