DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hk and Kcnab3

DIOPT Version :9

Sequence 1:NP_001259401.1 Gene:Hk / 31955 FlyBaseID:FBgn0263220 Length:887 Species:Drosophila melanogaster
Sequence 2:NP_113840.1 Gene:Kcnab3 / 58981 RGDID:61830 Length:404 Species:Rattus norvegicus


Alignment Length:353 Identity:164/353 - (46%)
Similarity:238/353 - (67%) Gaps:24/353 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 PALPLRHGSTPTPGLRYKNLGKSGLRISNVGLGTWPVFSPGVSDDQAEAILKLAIESGINLFDIS 253
            ||..||..:....|::|:||||||||:|.:|||||..|...:||:.||.:|.:|.|.|:||||.:
  Rat    64 PAGALRESTGRGTGMKYRNLGKSGLRVSCLGLGTWVTFGSQISDETAEDLLTVAYEHGVNLFDTA 128

  Fly   254 EAH----SETEIGKILQRAGWKRTAYVITTKVYWSTKSE-ERGLSRKHIIECVRASLQRLQLQYI 313
            |.:    :|..:|.||:..||:|::||||||::|..::| |||||||||||.::.||.||||:|:
  Rat   129 EVYAAGKAERTLGNILKSKGWRRSSYVITTKIFWGGQAETERGLSRKHIIEGLQGSLDRLQLEYV 193

  Fly   314 DIVIIHKADPMCPM-EVVRAMSYVIQQGWAMYWGTARWSQVEIMEAYTNCRQFNCITPIVEQSEY 377
            |||..:::||..|| |:||||:|||.||.|:||||:|||..||||||:..||||.|.|:.||:|.
  Rat   194 DIVFANRSDPSSPMEEIVRAMTYVINQGLALYWGTSRWSAAEIMEAYSMARQFNLIPPVCEQAEN 258

  Fly   378 HMFCREKCELYLPEMYNKIGVGLMAWGPLSMALSDTQNGDKLFLPKGSFKT-KSFSWTEDEINRN 441
            |.|.|||.|:.|||:|:|||||.:.|.||:.:|..::...:  :|.....| |.:.|.::::   
  Rat   259 HFFQREKVEMQLPELYHKIGVGSVTWSPLACSLITSKYDGQ--VPDACKATVKGYQWLKEKV--- 318

  Fly   442 AALSPQGSWGKDRIDEGRRHCDRLRDLAALAEKLGCSPTQLSIAWSLKHEPVQCLLLGATSAEQL 506
                        :.::|::...|:.||..:|.:|||:..||:|||.|:.|.|..:|||.:|||||
  Rat   319 ------------QSEDGKKQQARVTDLLPIAHQLGCTVAQLAIAWCLRSEGVSSVLLGVSSAEQL 371

  Fly   507 HQSLQSLQLLPRLSSSVMLELERILENK 534
            .:.|.|||:|.:|:...::|::.:|.||
  Rat   372 MEHLGSLQVLGQLTPQTVMEIDALLGNK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HkNP_001259401.1 Kv_beta 205..531 CDD:213602 156/332 (47%)
Aldo_ket_red 218..531 CDD:278668 146/319 (46%)
Kcnab3NP_113840.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..78 4/13 (31%)
Kv_beta 80..396 CDD:213602 156/332 (47%)
Aldo_ket_red 80..395 CDD:119408 156/331 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 302 1.000 Domainoid score I1351
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000530
OrthoInspector 1 1.000 - - otm46090
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR43150
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X715
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.870

Return to query results.
Submit another query.