DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hk and akr7a3

DIOPT Version :9

Sequence 1:NP_001259401.1 Gene:Hk / 31955 FlyBaseID:FBgn0263220 Length:887 Species:Drosophila melanogaster
Sequence 2:NP_001002369.1 Gene:akr7a3 / 436642 ZFINID:ZDB-GENE-040718-62 Length:323 Species:Danio rerio


Alignment Length:312 Identity:68/312 - (21%)
Similarity:132/312 - (42%) Gaps:34/312 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 SGLRISNVGLGTWPVFSPGVSDDQAEAILKLAIESGINLFDISEAHSETEIGKILQRAGWKRTAY 275
            ||..|....|||. .|........:..::::.:|.|.:..|.:..:::.:...|:.......|..
Zfish     2 SGSSIPVTLLGTM-AFGGRADAHMSSQLVRVFLERGHSELDTALMYNDGQAESIIGDMQLPETVR 65

  Fly   276 VITTKVYWSTKSEERGLSRKHIIECVRASLQRLQLQYIDIVIIHKADPMCPM-EVVRAMSYVIQQ 339
            :.|....|..|:.:....||.:    .:||:||:.|.:.|..:|..|...|: :.::|.:.:.::
Zfish    66 IATKANPWEGKTLKPDSVRKQL----ESSLKRLRRQTVQIFYLHAPDHQNPIQDTLQACNQLHKE 126

  Fly   340 GWAMYWGTARWSQVEIMEAYTNCRQFNCITPIVEQSEYHMFCREKCELYLPEMYNKIGVGLMAWG 404
            |.....|.:.::..|:.|.|:.|:..|.:.|.|.|..|:...|: .|..|.......|:...|:.
Zfish   127 GKFEELGLSNYASWEVAEIYSICKHNNWVLPTVYQGMYNATTRQ-VETELLPCLRYFGIRFFAYN 190

  Fly   405 PLSMAL------SDTQNGDKLFLPKGSFKTKSFSWTEDEINRNAALSPQGSWGKDRIDEGRRHCD 463
            ||:..|      .:.::|.:   |.|.|           ...|.|.:.:..:.|:...:|.....
Zfish   191 PLAGGLLTGKYHYEDKDGAQ---PAGRF-----------FGNNWANAYRDRYWKESHFQGIDGVQ 241

  Fly   464 RLRDLAALAEKLGCSPTQLSIAWSLKHEPVQ-----CLLLGATSAEQLHQSL 510
            :..:.|..:||  .|.|..:|.|...|..::     .:::|.:|.|||:::|
Zfish   242 KALESAYGSEK--PSLTSAAIRWMYHHSHLKGDQGDGVIIGMSSMEQLNENL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HkNP_001259401.1 Kv_beta 205..531 CDD:213602 68/312 (22%)
Aldo_ket_red 218..531 CDD:278668 65/305 (21%)
akr7a3NP_001002369.1 Tas 2..319 CDD:223739 68/312 (22%)
Aldo_ket_red 2..310 CDD:119408 68/312 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.