DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hk and SPAC750.01

DIOPT Version :9

Sequence 1:NP_001259401.1 Gene:Hk / 31955 FlyBaseID:FBgn0263220 Length:887 Species:Drosophila melanogaster
Sequence 2:NP_001343040.1 Gene:SPAC750.01 / 3361570 PomBaseID:SPAC750.01 Length:325 Species:Schizosaccharomyces pombe


Alignment Length:315 Identity:81/315 - (25%)
Similarity:140/315 - (44%) Gaps:60/315 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 DDQAEAILKLAIESGINLFDISEAH----SETEIGKILQRAGWKRTAYVITTKVYWSTKSE---- 288
            :|:...|:|.|.::||..||.:..:    ||..:||.:::....|::.||.:|.:...:.:    
pombe    17 EDEVFKIMKAAYDAGIRTFDTANIYSAGVSEELVGKFIRKYEIPRSSIVIMSKCFSPVRKDLIKL 81

  Fly   289 -------------------ERGLSRKHIIECVRASLQRLQLQYIDIVIIHKADP-MCPMEVVRAM 333
                               :.|||||||.:.|:.|::||. .|||::.||:.|| :...||:||:
pombe    82 YMDLSSRGVQLHDSPELANQCGLSRKHIFDAVQDSVKRLG-TYIDVLQIHRYDPHVSAEEVMRAL 145

  Fly   334 SYVIQQGWAMYWGTARWSQVEIMEAYTNCRQFNCITPIVEQSEYHMFCREKCELYLPEMYNKIGV 398
            :.|::.|...|.|.:.....:.:|......:......|..|:.:::..||:....:| ...|.||
pombe   146 NDVVESGKVRYIGASTMRYYQFIELQNTAEKHGWHKFISMQNYHNLLYREEEREMIP-YCQKTGV 209

  Fly   399 GLMAWGPLSMALSDTQNGDKLFLPKGSFKTKSFSWTEDEINRNAALSPQGSWGKDRIDEGRRHCD 463
            ||:.|.||:..|                .|:|....|:.|.....|..:.      ::.|..:..
pombe   210 GLIPWSPLARGL----------------LTRSIDANEETIRSKTDLYTRA------LEFGAGYKA 252

  Fly   464 RLRDLAALAEKLGCSPTQLSIAWSLKHE---PVQCLLLGATSAEQLHQSLQSLQL 515
            .|..:..||:|...|...|:.|||| |:   |:    :|.:..|:|..:|.|:.|
pombe   253 ILSRVEELAKKYNVSMATLATAWSL-HKGDYPI----VGISKVERLQDALASVTL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HkNP_001259401.1 Kv_beta 205..531 CDD:213602 81/315 (26%)
Aldo_ket_red 218..531 CDD:278668 81/315 (26%)
SPAC750.01NP_001343040.1 Tas 1..316 CDD:223739 81/315 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000530
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.