DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hk and Kcnab2

DIOPT Version :9

Sequence 1:NP_001259401.1 Gene:Hk / 31955 FlyBaseID:FBgn0263220 Length:887 Species:Drosophila melanogaster
Sequence 2:XP_017448703.1 Gene:Kcnab2 / 29738 RGDID:61828 Length:383 Species:Rattus norvegicus


Alignment Length:386 Identity:178/386 - (46%)
Similarity:251/386 - (65%) Gaps:54/386 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 GSNPALPLRHGSTPTPGL--------------RYKNLGKSGLRISNVGLGTWPVFSPGVSDDQAE 236
            ||...|.||  .|.:||:              .|:||||||||:|.:|||||..|...::|:.||
  Rat     8 GSPARLSLR--QTGSPGMIYSTRYGSPKRQLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAE 70

  Fly   237 AILKLAIESGINLFDISEAH----SETEIGKILQRAGWKRTAYVITTKVYWSTKSE-ERGLSRKH 296
            .::.||.::||||||.:|.:    :|..:|.|:::.||:|::.|||||::|..|:| ||||||||
  Rat    71 HLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKH 135

  Fly   297 IIECVRASLQRLQLQYIDIVIIHKADPMCPM-----------------EVVRAMSYVIQQGWAMY 344
            |||.::|||:||||:|:|:|..::.||..||                 |.||||::||.||.|||
  Rat   136 IIEGLKASLERLQLEYVDVVFANRPDPNTPMEAGDPFSSFKSRTFIIEETVRAMTHVINQGMAMY 200

  Fly   345 WGTARWSQVEIMEAYTNCRQFNCITPIVEQSEYHMFCREKCELYLPEMYNKIGVGLMAWGPLSMA 409
            |||:|||.:||||||:..||||.|.||.||:|||||.|||.|:.|||:::|||||.|.|.||:..
  Rat   201 WGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACG 265

  Fly   410 LSDTQNGDKLFLPKGSFKTKSFSWTEDEINRNAALSPQGSWGKDRIDEGRRHCDRLRDLAALAEK 474
            :...:. |....|......|.:.|.:|:|     ||          :||||...:|::|.|:||:
  Rat   266 IVSGKY-DSGIPPYSRASLKGYQWLKDKI-----LS----------EEGRRQQAKLKELQAIAER 314

  Fly   475 LGCSPTQLSIAWSLKHEPVQCLLLGATSAEQLHQSLQSLQLLPRLSSSVMLELERILENKP 535
            |||:..||:|||.|::|.|..:||||::||||.:::.::|:||:||||::.|::.||.|||
  Rat   315 LGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HkNP_001259401.1 Kv_beta 205..531 CDD:213602 165/347 (48%)
Aldo_ket_red 218..531 CDD:278668 155/334 (46%)
Kcnab2XP_017448703.1 Aldo_ket_red_shaker 38..363 CDD:381367 163/340 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 302 1.000 Domainoid score I1351
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000530
OrthoInspector 1 1.000 - - otm46090
orthoMCL 1 0.900 - - OOG6_100387
Panther 1 1.100 - - O PTHR43150
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X715
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.