DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hk and Akr7a3

DIOPT Version :9

Sequence 1:NP_001259401.1 Gene:Hk / 31955 FlyBaseID:FBgn0263220 Length:887 Species:Drosophila melanogaster
Sequence 2:XP_038965272.1 Gene:Akr7a3 / 26760 RGDID:628635 Length:387 Species:Rattus norvegicus


Alignment Length:399 Identity:87/399 - (21%)
Similarity:145/399 - (36%) Gaps:118/399 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 LRYKNLGKSGLRISNVGLGTWP----VFSPGVSDDQAEAILKL-AIESGINL------------- 249
            |..:.|..:|||.:...:.::|    ..|..|:..||.....| |:|.|..:             
  Rat    28 LSQRPLVTTGLRTAGTNVLSYPPPSSATSTTVTMSQARPATVLGAMEMGRRMDVTSSSASVRAFL 92

  Fly   250 ----------FDISEAHSETEIGKI---LQRAGWKRTAYVITTKVYWSTKSEE---RGLSRKHII 298
                      |..:...|||.:|.:   |.|:|         .||..:||:..   :.|....:.
  Rat    93 QRGHTEIDTAFVYANGQSETILGDLGLGLGRSG---------CKVKIATKAAPMFGKTLKPADVR 148

  Fly   299 ECVRASLQRLQLQYIDIVIIHKADPMCPM-EVVRAMSYVIQQGWAMYWGTARWSQVEIMEAYTNC 362
            ..:..||:|||...:|:..:|..|...|: |.::|...:.|:|..:..|.:.:...|:.|..|.|
  Rat   149 FQLETSLKRLQCPRVDLFYLHFPDHGTPIEETLQACHQLHQEGKFVELGLSNYVSWEVAEICTLC 213

  Fly   363 RQFNCITPIVEQSEYHMFCRE-KCELYLPEMYNKIGVGLMAWGPLSMAL---------SDTQNGD 417
            ::...|.|.|.|..|:...|: :.||:  ......|:...|:.||:..|         .|.:|  
  Rat   214 KKNGWIMPTVYQGMYNAITRQVETELF--PCLRHFGLRFYAFNPLAGGLLTGRYKYQDKDGKN-- 274

  Fly   418 KLFLPKGSFKTKSFS-------WTEDEINRNAALSPQGSWGKDRIDEGRRHCDRLRDLAALAEKL 475
                |:..|....||       |.|:..|..|.:.                       .||....
  Rat   275 ----PESRFFGNPFSQLYMDRYWKEEHFNGIALVE-----------------------KALKTTY 312

  Fly   476 G-CSPTQLSIA--WSLKHEPVQ-----CLLLGATSAEQLHQSLQSLQLLPRLSSSVMLELERILE 532
            | .:|:.:|.|  |...|..::     .::||.:|.|||.|:|                  .::|
  Rat   313 GPTAPSMISAAVRWMYHHSQLKGTQGDAVILGMSSLEQLEQNL------------------ALVE 359

  Fly   533 NKPVRPPMI 541
            ..|:.|.::
  Rat   360 EGPLEPAVV 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HkNP_001259401.1 Kv_beta 205..531 CDD:213602 83/385 (22%)
Aldo_ket_red 218..531 CDD:278668 79/372 (21%)
Akr7a3XP_038965272.1 AKR_AKR7A1-5 66..375 CDD:381301 77/361 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352431
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.