DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsyndelta and AT5G47030

DIOPT Version :9

Sequence 1:NP_001259397.1 Gene:ATPsyndelta / 31950 FlyBaseID:FBgn0028342 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_199514.1 Gene:AT5G47030 / 834749 AraportID:AT5G47030 Length:203 Species:Arabidopsis thaliana


Alignment Length:201 Identity:57/201 - (28%)
Similarity:95/201 - (47%) Gaps:56/201 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FVKNARLL----AARGARLAQNRSYSDEMKLTFAAANKTFYDA---------------------- 41
            |.:.:|||    ||..::....|::|.|:..|.   :.||.:|                      
plant     2 FKQASRLLSRSVAAASSKSVTTRAFSTELPSTL---DSTFVEAWKKVAPNMDPPQTPSAFMKPRP 63

  Fly    42 ---------------------AVVRQID---VPSFSGSFGILAKHVPTLAVLKPGVVQVVE-NDG 81
                                 ...:::|   :|:.:|..|:|..||||:|.||||::.|.| .|.
plant    64 STPSSIPTKLTVNFVLPYTSELTGKEVDMVIIPASTGQMGVLPGHVPTIAELKPGIMSVHEGTDV 128

  Fly    82 KTLKFFVSSGSVTVNEDSSVQVLAEEAHNIEDIDANEARQLLAKYQSQLSSAGDDKAKAQAAIAV 146
            |  |:|:|||...::.:|...::|.||..::.||.::.::.||::|.:|:||..|..||:|.|.|
plant   129 K--KYFLSSGFAFLHANSVADIIAVEAVPLDHIDPSQVQKGLAEFQQKLASATTDLEKAEAQIGV 191

  Fly   147 EVAEAL 152
            ||..|:
plant   192 EVHSAI 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsyndeltaNP_001259397.1 F1-ATPase_delta 27..141 CDD:213395 41/160 (26%)
AT5G47030NP_199514.1 F1-ATPase_delta 73..196 CDD:213395 43/124 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I4712
eggNOG 1 0.900 - - E1_COG0355
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37514
Inparanoid 1 1.050 78 1.000 Inparanoid score I2395
OMA 1 1.010 - - QHG53851
OrthoDB 1 1.010 - - D1286602at2759
OrthoFinder 1 1.000 - - FOG0003148
OrthoInspector 1 1.000 - - oto3884
orthoMCL 1 0.900 - - OOG6_101225
Panther 1 1.100 - - LDO PTHR13822
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.