DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsyndelta and ATP5F1D

DIOPT Version :9

Sequence 1:NP_001259397.1 Gene:ATPsyndelta / 31950 FlyBaseID:FBgn0028342 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001001975.1 Gene:ATP5F1D / 513 HGNCID:837 Length:168 Species:Homo sapiens


Alignment Length:154 Identity:75/154 - (48%)
Similarity:102/154 - (66%) Gaps:1/154 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VKNARLLAARGARLAQNRSYSDEMKLTFAAANKTFYDAAVVRQIDVPSFSGSFGILAKHVPTLAV 68
            |::||..|...|..|. .|..::|..|||:..:.|::.|.|||:|||:.:|:|||||.|||||.|
Human    16 VRHARAYAEAAAAPAA-ASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQV 79

  Fly    69 LKPGVVQVVENDGKTLKFFVSSGSVTVNEDSSVQVLAEEAHNIEDIDANEARQLLAKYQSQLSSA 133
            |:||:|.|...||.|.|:||||||:.||.|||||:|||||..::.:|...|:..|.|.|::|...
Human    80 LRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGT 144

  Fly   134 GDDKAKAQAAIAVEVAEALVKAAE 157
            .|:..:|:..|.:|..||||||.|
Human   145 ADEATRAEIQIRIEANEALVKALE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsyndeltaNP_001259397.1 F1-ATPase_delta 27..141 CDD:213395 58/113 (51%)
ATP5F1DNP_001001975.1 F1-ATPase_delta 38..162 CDD:213395 61/123 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152380
Domainoid 1 1.000 104 1.000 Domainoid score I6739
eggNOG 1 0.900 - - E1_COG0355
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37514
Inparanoid 1 1.050 136 1.000 Inparanoid score I4575
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53851
OrthoDB 1 1.010 - - D1286602at2759
OrthoFinder 1 1.000 - - FOG0003148
OrthoInspector 1 1.000 - - oto88657
orthoMCL 1 0.900 - - OOG6_101225
Panther 1 1.100 - - LDO PTHR13822
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R119
SonicParanoid 1 1.000 - - X4680
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.