DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsyndelta and atp5f1d

DIOPT Version :9

Sequence 1:NP_001259397.1 Gene:ATPsyndelta / 31950 FlyBaseID:FBgn0028342 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_956262.1 Gene:atp5f1d / 335709 ZFINID:ZDB-GENE-030131-7649 Length:159 Species:Danio rerio


Alignment Length:156 Identity:82/156 - (52%)
Similarity:106/156 - (67%) Gaps:5/156 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ARLLAARGA-RLAQNRSYSD----EMKLTFAAANKTFYDAAVVRQIDVPSFSGSFGILAKHVPTL 66
            ||.|..|.| .|...|||:|    :|..|||:..:.|:..|.|:|||||:.:|:||||..|||||
Zfish     4 ARFLLRRAAPALRHARSYADAPSAQMSFTFASPTEVFFKEASVKQIDVPTLTGAFGILPAHVPTL 68

  Fly    67 AVLKPGVVQVVENDGKTLKFFVSSGSVTVNEDSSVQVLAEEAHNIEDIDANEARQLLAKYQSQLS 131
            .||:||||.|..:||.:.|:||||||||||.|||||:|||||..:|.:|...|:..|.|.||:|.
Zfish    69 QVLRPGVVTVFNDDGSSKKYFVSSGSVTVNADSSVQLLAEEAFPLESLDVAAAKANLEKAQSELV 133

  Fly   132 SAGDDKAKAQAAIAVEVAEALVKAAE 157
            ||.|:..:|:..|::|..||:|||.|
Zfish   134 SASDEATRAEVLISIEANEAIVKALE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsyndeltaNP_001259397.1 F1-ATPase_delta 27..141 CDD:213395 63/113 (56%)
atp5f1dNP_956262.1 AtpC 27..158 CDD:223432 70/130 (54%)
F1-ATPase_delta 29..153 CDD:213395 66/123 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586869
Domainoid 1 1.000 105 1.000 Domainoid score I6620
eggNOG 1 0.900 - - E1_COG0355
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37514
Inparanoid 1 1.050 146 1.000 Inparanoid score I4405
OMA 1 1.010 - - QHG53851
OrthoDB 1 1.010 - - D1286602at2759
OrthoFinder 1 1.000 - - FOG0003148
OrthoInspector 1 1.000 - - oto41318
orthoMCL 1 0.900 - - OOG6_101225
Panther 1 1.100 - - LDO PTHR13822
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R119
SonicParanoid 1 1.000 - - X4680
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.