DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsyndelta and atp16

DIOPT Version :9

Sequence 1:NP_001259397.1 Gene:ATPsyndelta / 31950 FlyBaseID:FBgn0028342 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_596259.2 Gene:atp16 / 2540185 PomBaseID:SPBC13E7.04 Length:167 Species:Schizosaccharomyces pombe


Alignment Length:138 Identity:47/138 - (34%)
Similarity:81/138 - (58%) Gaps:1/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AQNRSYSDEMKLTFAAANKTFYDAAVVRQIDVPSFSGSFGILAKHVPTLAVLKPGVVQVVENDGK 82
            ||....::::.|:.|...:|.|:...|.|:|:|:..|..|||..|||.:..|||||:.|.:....
pombe    29 AQAVQKNEKLVLSMALPYQTIYEKVPVTQVDIPAEDGEMGILKDHVPMIQCLKPGVISVTDESSN 93

  Fly    83 TLKFFVSSGSVTVNEDSSVQVLAEEAHNIEDIDANEARQLLAKYQSQLSSAGDDKAKAQAAIAVE 147
            ..|:|:|.|.......:.:.:...||:.:||..::.|.|||.|::::::|: |:...|:||:.|.
pombe    94 KSKYFISGGFAVQQPSNELSITVPEAYKLEDFSSSVANQLLEKHKAEMNSS-DEGVAAEAAVRVS 157

  Fly   148 VAEALVKA 155
            |.|:||:|
pombe   158 VLESLVRA 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsyndeltaNP_001259397.1 F1-ATPase_delta 27..141 CDD:213395 36/113 (32%)
atp16NP_596259.2 AtpC 38..167 CDD:223432 45/129 (35%)
F1-ATPase_delta 40..153 CDD:213395 37/113 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3141
eggNOG 1 0.900 - - E1_COG0355
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37514
Inparanoid 1 1.050 95 1.000 Inparanoid score I1701
OMA 1 1.010 - - QHG53851
OrthoFinder 1 1.000 - - FOG0003148
OrthoInspector 1 1.000 - - oto100595
orthoMCL 1 0.900 - - OOG6_101225
Panther 1 1.100 - - LDO PTHR13822
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R119
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.