DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsyndelta and Atp5f1d

DIOPT Version :9

Sequence 1:NP_001259397.1 Gene:ATPsyndelta / 31950 FlyBaseID:FBgn0028342 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_006240907.1 Gene:Atp5f1d / 245965 RGDID:621372 Length:229 Species:Rattus norvegicus


Alignment Length:165 Identity:83/165 - (50%)
Similarity:106/165 - (64%) Gaps:14/165 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ARLLAARGAR--LAQNRSYSD------------EMKLTFAAANKTFYDAAVVRQIDVPSFSGSFG 57
            |.||...|.|  :.|.|:|:.            :|..|||:..:.|:|.|.|||:|||:.:|:||
  Rat    65 AALLRHPGLRRLVLQARTYAQAAASPAPAAGPGQMSFTFASPTQVFFDGANVRQVDVPTLTGAFG 129

  Fly    58 ILAKHVPTLAVLKPGVVQVVENDGKTLKFFVSSGSVTVNEDSSVQVLAEEAHNIEDIDANEARQL 122
            |||.|||||.||:||:|.|...||.|.|:||||||||||.|||||:||||...::.:|...||..
  Rat   130 ILASHVPTLQVLRPGLVVVHAEDGTTTKYFVSSGSVTVNADSSVQLLAEEVVTLDMLDLGAARAN 194

  Fly   123 LAKYQSQLSSAGDDKAKAQAAIAVEVAEALVKAAE 157
            |.|.||:||.|.|:.|:|:..|.:|..||||||.|
  Rat   195 LEKAQSELSGAADEAARAEIQIRIEANEALVKALE 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsyndeltaNP_001259397.1 F1-ATPase_delta 27..141 CDD:213395 65/113 (58%)
Atp5f1dXP_006240907.1 AtpC 98..228 CDD:223432 73/129 (57%)
F1-ATPase_delta 99..223 CDD:213395 68/123 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345887
Domainoid 1 1.000 109 1.000 Domainoid score I6248
eggNOG 1 0.900 - - E1_COG0355
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37514
Inparanoid 1 1.050 146 1.000 Inparanoid score I4329
OMA 1 1.010 - - QHG53851
OrthoDB 1 1.010 - - D1286602at2759
OrthoFinder 1 1.000 - - FOG0003148
OrthoInspector 1 1.000 - - oto95789
orthoMCL 1 0.900 - - OOG6_101225
Panther 1 1.100 - - LDO PTHR13822
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4680
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.