DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsyndelta and F58F12.1

DIOPT Version :9

Sequence 1:NP_001259397.1 Gene:ATPsyndelta / 31950 FlyBaseID:FBgn0028342 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_495286.1 Gene:F58F12.1 / 174059 WormBaseID:WBGene00019061 Length:163 Species:Caenorhabditis elegans


Alignment Length:156 Identity:73/156 - (46%)
Similarity:103/156 - (66%) Gaps:5/156 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VKNARLLAARG---ARLAQNRSYSDEMKLTFAAANKTFYDAAVVRQIDVPSFSGSFGILAKHVPT 65
            ::...::|.||   |..|.|.: .:|::||||:.:...:..|||:|:|||:.:|..|:||.||||
 Worm     6 IQRFSVVAKRGYAAAAPAANAN-PEELRLTFASPDTAVFSNAVVKQVDVPTLAGMVGVLANHVPT 69

  Fly    66 LAVLKPGVVQVVENDGKTLKFFVSSGSVTVNEDSSVQVLAEEAHNIEDIDANEARQLLAKYQSQL 130
            :.|||||||.|..|:|...:.|||||:::||.|.|.||||||...:|:||.:.||..|...| :.
 Worm    70 IGVLKPGVVSVTTNEGTVQRLFVSSGTLSVNIDGSCQVLAEEVLKVEEIDESAARAELDAAQ-RA 133

  Fly   131 SSAGDDKAKAQAAIAVEVAEALVKAA 156
            |..|.:.|:|:|.|..||||||:|||
 Worm   134 SGEGSEVARAEAQIRAEVAEALIKAA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsyndeltaNP_001259397.1 F1-ATPase_delta 27..141 CDD:213395 54/113 (48%)
F58F12.1NP_495286.1 AtpC 30..153 CDD:223432 60/123 (49%)
F1-ATPase_delta 31..154 CDD:213395 60/123 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162471
Domainoid 1 1.000 94 1.000 Domainoid score I4751
eggNOG 1 0.900 - - E1_COG0355
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37514
Inparanoid 1 1.050 128 1.000 Inparanoid score I3250
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53851
OrthoDB 1 1.010 - - D1286602at2759
OrthoFinder 1 1.000 - - FOG0003148
OrthoInspector 1 1.000 - - oto19011
orthoMCL 1 0.900 - - OOG6_101225
Panther 1 1.100 - - LDO PTHR13822
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R119
SonicParanoid 1 1.000 - - X4680
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.