DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15309 and AT3G55890

DIOPT Version :9

Sequence 1:NP_001096936.1 Gene:CG15309 / 31949 FlyBaseID:FBgn0030183 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001325433.1 Gene:AT3G55890 / 824755 AraportID:AT3G55890 Length:121 Species:Arabidopsis thaliana


Alignment Length:89 Identity:49/89 - (55%)
Similarity:68/89 - (76%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLHAVADIYCECCKTP 80
            |.|..|:.||::..:::|||||...|.|||||:||||:.|:.|:|:::||||.|.||:|..|.:.
plant    14 YICKLCKTHLSTDQDIMSKSFQCKNGRAYLFNNVVNVSVGEKEDRMMITGLHNVVDIFCVGCGSN 78

  Fly    81 LGWKYEHAYESSQKYKEGKFIIEL 104
            :|||||.|:|.||||||||.::||
plant    79 VGWKYEFAHEKSQKYKEGKSVLEL 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15309NP_001096936.1 RLR_C_like 15..103 CDD:416942 47/86 (55%)
AT3G55890NP_001325433.1 RLR_C_like 16..106 CDD:416942 48/87 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X404
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.690

Return to query results.
Submit another query.