DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15309 and AT3G11230

DIOPT Version :9

Sequence 1:NP_001096936.1 Gene:CG15309 / 31949 FlyBaseID:FBgn0030183 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001078135.1 Gene:AT3G11230 / 820293 AraportID:AT3G11230 Length:162 Species:Arabidopsis thaliana


Alignment Length:113 Identity:53/113 - (46%)
Similarity:75/113 - (66%) Gaps:14/113 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FQAYLPSTN--------------RTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACG 55
            |.|::.|.|              ::|||.||:.:||..|:::|||||...|.||||:.||||..|
plant    22 FFAFIDSGNSLEMGRLFLVNLEGKSYSCKHCKTNLALCDDVVSKSFQSRHGKAYLFSKVVNVYAG 86

  Fly    56 QTEERVLLTGLHAVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIE 103
            :.|:|:::||:|.|.||||..|.:.:|||||.|:|.:|||||||.::|
plant    87 KKEDRMMMTGMHTVVDIYCVKCGSYVGWKYEFAFEKNQKYKEGKSVLE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15309NP_001096936.1 RLR_C_like 15..103 CDD:416942 48/87 (55%)
AT3G11230NP_001078135.1 RLR_C_like 47..134 CDD:300620 48/86 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X404
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.690

Return to query results.
Submit another query.