DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15309 and AT2G40110

DIOPT Version :9

Sequence 1:NP_001096936.1 Gene:CG15309 / 31949 FlyBaseID:FBgn0030183 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_181540.1 Gene:AT2G40110 / 818600 AraportID:AT2G40110 Length:130 Species:Arabidopsis thaliana


Alignment Length:90 Identity:51/90 - (56%)
Similarity:70/90 - (77%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLHAVADIYCECCK 78
            :.|||.||:.|||:::::|||||....|.|||||.|.||:.|:||||:::||.|.||||:|..|.
plant    12 KIYSCKHCKTHLATYEDIISKSFHCKHGKAYLFNKVANVSIGETEERLMMTGKHTVADIFCVSCG 76

  Fly    79 TPLGWKYEHAYESSQKYKEGKFIIE 103
            :.:|||||.|:|.:|||||||.::|
plant    77 SIVGWKYETAHEKNQKYKEGKSVLE 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15309NP_001096936.1 RLR_C_like 15..103 CDD:416942 50/87 (57%)
AT2G40110NP_181540.1 RLR_C_like 13..106 CDD:416942 51/89 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X404
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.690

Return to query results.
Submit another query.