DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15309 and Ypel3

DIOPT Version :9

Sequence 1:NP_001096936.1 Gene:CG15309 / 31949 FlyBaseID:FBgn0030183 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001366222.1 Gene:Ypel3 / 66090 MGIID:1913340 Length:119 Species:Mus musculus


Alignment Length:112 Identity:92/112 - (82%)
Similarity:99/112 - (88%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTFQAYLPSTNRTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLH 67
            |||||||...:|.|||.|||||||:||:|||||||||||.||||||||||.||..||||||||||
Mouse     8 KTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLH 72

  Fly    68 AVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGWD 114
            |||||:||.|||.||||||.|:||||||||||:||||.||||:||||
Mouse    73 AVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15309NP_001096936.1 RLR_C_like 15..103 CDD:416942 73/87 (84%)
Ypel3NP_001366222.1 RLR_C_like 21..110 CDD:416942 75/88 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 177 1.000 Domainoid score I3568
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3601
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 1 1.000 - - otm43974
orthoMCL 1 0.900 - - OOG6_100480
Panther 1 1.100 - - LDO PTHR13848
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2192
SonicParanoid 1 1.000 - - X404
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.