powered by:
Protein Alignment CG15309 and slc30a10
DIOPT Version :9
Sequence 1: | NP_001096936.1 |
Gene: | CG15309 / 31949 |
FlyBaseID: | FBgn0030183 |
Length: | 114 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001121706.2 |
Gene: | slc30a10 / 555724 |
ZFINID: | ZDB-GENE-060608-2 |
Length: | 385 |
Species: | Danio rerio |
Alignment Length: | 31 |
Identity: | 8/31 - (25%) |
Similarity: | 15/31 - (48%) |
Gaps: | 7/31 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 LISKSFQGSQGPAYLFNSVVNVACGQTEERV 61
|:|.||. :.:.::::..|.|..||
Zfish 37 LVSDSFN-------MLSDILSLCVGLTAARV 60
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1431042at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.