DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15309 and ypel1

DIOPT Version :9

Sequence 1:NP_001096936.1 Gene:CG15309 / 31949 FlyBaseID:FBgn0030183 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001016705.1 Gene:ypel1 / 549459 XenbaseID:XB-GENE-998682 Length:119 Species:Xenopus tropicalis


Alignment Length:112 Identity:98/112 - (87%)
Similarity:105/112 - (93%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTFQAYLPSTNRTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLH 67
            ||||||||:.:|||||:|||||||:||||||||||||||.||||||||||.||..||||||||||
 Frog     8 KTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLH 72

  Fly    68 AVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGWD 114
            ||||||||.|||.||||||||:||||||||||||||||||||:|||:
 Frog    73 AVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15309NP_001096936.1 RLR_C_like 15..103 CDD:416942 78/87 (90%)
ypel1NP_001016705.1 RLR_C_like 20..108 CDD:416942 78/87 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 178 1.000 Domainoid score I3500
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3521
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 1 1.000 - - otm49149
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X404
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.