DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15309 and Ypel4

DIOPT Version :9

Sequence 1:NP_001096936.1 Gene:CG15309 / 31949 FlyBaseID:FBgn0030183 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001019540.1 Gene:Ypel4 / 502643 RGDID:1560142 Length:127 Species:Rattus norvegicus


Alignment Length:112 Identity:87/112 - (77%)
Similarity:101/112 - (90%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTFQAYLPSTNRTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLH 67
            |||::|||..:|||||||||||||.||||||||||||.|.||||||||||.||..|:|:||||||
  Rat    16 KTFRSYLPRCHRTYSCVHCRAHLAKHDELISKSFQGSHGRAYLFNSVVNVGCGPAEQRLLLTGLH 80

  Fly    68 AVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGWD 114
            :||||:||.|||.||||||.|:|:||||||||:|||::||:|:||||
  Rat    81 SVADIFCESCKTTLGWKYEQAFETSQKYKEGKYIIEMSHMVKDNGWD 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15309NP_001096936.1 RLR_C_like 15..103 CDD:416942 71/87 (82%)
Ypel4NP_001019540.1 RLR_C_like 28..118 CDD:416942 73/89 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I3564
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 1 1.000 - - otm46064
orthoMCL 1 0.900 - - OOG6_100480
Panther 1 1.100 - - O PTHR13848
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X404
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.