DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15309 and ypel3

DIOPT Version :9

Sequence 1:NP_001096936.1 Gene:CG15309 / 31949 FlyBaseID:FBgn0030183 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_997955.1 Gene:ypel3 / 368214 ZFINID:ZDB-GENE-030516-4 Length:119 Species:Danio rerio


Alignment Length:112 Identity:93/112 - (83%)
Similarity:100/112 - (89%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTFQAYLPSTNRTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLH 67
            |||||||.|.:|.|||||||||||:||:|||||||||||.||||||||||.||..|||:||||||
Zfish     8 KTFQAYLDSCHRRYSCVHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERLLLTGLH 72

  Fly    68 AVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGWD 114
            ||||||||.|.|.||||||.|:|.|||||||||||||:||||:||||
Zfish    73 AVADIYCENCHTTLGWKYEQAFELSQKYKEGKFIIELSHMIKDNGWD 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15309NP_001096936.1 RLR_C_like 15..103 CDD:416942 73/87 (84%)
ypel3NP_997955.1 RLR_C_like 21..110 CDD:416942 75/88 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 178 1.000 Domainoid score I3511
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3591
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 1 1.000 - - otm24428
orthoMCL 1 0.900 - - OOG6_100480
Panther 1 1.100 - - LDO PTHR13848
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2192
SonicParanoid 1 1.000 - - X404
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.