DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15309 and L2HGDH

DIOPT Version :9

Sequence 1:NP_001096936.1 Gene:CG15309 / 31949 FlyBaseID:FBgn0030183 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001286076.1 Gene:L2HGDH / 35156 FlyBaseID:FBgn0032729 Length:455 Species:Drosophila melanogaster


Alignment Length:126 Identity:28/126 - (22%)
Similarity:43/126 - (34%) Gaps:44/126 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 HCRAHLASHD------------ELISKSFQGSQGPAYL-FN---------------SVVNVACGQ 56
            :|:..:|.|.            |...:.|:...|..|| ||               ::.....||
  Fly   172 YCQGVMALHSPHTGIVDWGLVTEHYGQDFKQCGGDIYLDFNVSKFTETKEGTDYPVTIHGAKPGQ 236

  Fly    57 T-EERVLLT--GLHAVADIYCE---CCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKEN 111
            | ..:.:||  ||.  :|:..|   |.:.|....:...|....|.|:        ||:|.|
  Fly   237 TVRTKNVLTCGGLQ--SDLLAEKTGCPRDPRIVPFRGEYLLLTKEKQ--------HMVKGN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15309NP_001096936.1 RLR_C_like 15..103 CDD:416942 24/116 (21%)
L2HGDHNP_001286076.1 PRK11728 56..447 CDD:183292 28/126 (22%)
NADB_Rossmann 69..440 CDD:304358 28/126 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456416
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.