DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15309 and Yippee

DIOPT Version :9

Sequence 1:NP_001096936.1 Gene:CG15309 / 31949 FlyBaseID:FBgn0030183 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_572882.1 Gene:Yippee / 32295 FlyBaseID:FBgn0026749 Length:121 Species:Drosophila melanogaster


Alignment Length:100 Identity:45/100 - (45%)
Similarity:62/100 - (62%) Gaps:0/100 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLHAVADIYCECCK 78
            :.::|..|..:|.:..:|||..|.|:.|.||||..|||:.....:|||:|||.|.|.|:.|:.|.
  Fly    13 KLFNCAQCHTNLTNRSQLISTRFTGATGRAYLFKRVVNLTFSNIQERVMLTGRHMVRDVMCKNCG 77

  Fly    79 TPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGW 113
            ..|||.||.|.|.|||||||:.|:|.|.:.:..|:
  Fly    78 AKLGWMYEFATEESQKYKEGRVILEYALITEAEGF 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15309NP_001096936.1 RLR_C_like 15..103 CDD:416942 42/87 (48%)
YippeeNP_572882.1 RLR_C_like 15..107 CDD:416942 44/91 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456410
Domainoid 1 1.000 79 1.000 Domainoid score I2356
eggNOG 1 0.900 - - E1_KOG3399
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I1837
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 1 1.000 - - otm47264
orthoMCL 1 0.900 - - OOG6_100480
Panther 1 1.100 - - P PTHR13848
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2192
SonicParanoid 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.