DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15309 and Ypel5

DIOPT Version :9

Sequence 1:NP_001096936.1 Gene:CG15309 / 31949 FlyBaseID:FBgn0030183 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001030298.1 Gene:Ypel5 / 298792 RGDID:1309657 Length:121 Species:Rattus norvegicus


Alignment Length:114 Identity:49/114 - (42%)
Similarity:72/114 - (63%) Gaps:1/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKTFQAYLPSTNRTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTG 65
            |.:.|..::..| |.:||.:|...|.:..||||..|.|:.|.|:|||.|||:...:.::||:|||
  Rat     1 MGRIFLDHIGGT-RLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTG 64

  Fly    66 LHAVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGWD 114
            .|.|.|:.|:.|.:.|||.||.|.|.||:||||:.|:|.|.:.:..|::
  Rat    65 RHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFE 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15309NP_001096936.1 RLR_C_like 15..103 CDD:416942 42/87 (48%)
Ypel5NP_001030298.1 RLR_C_like 15..107 CDD:416942 44/91 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.