DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15309 and B0546.4

DIOPT Version :9

Sequence 1:NP_001096936.1 Gene:CG15309 / 31949 FlyBaseID:FBgn0030183 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_500335.1 Gene:B0546.4 / 177105 WormBaseID:WBGene00015251 Length:161 Species:Caenorhabditis elegans


Alignment Length:112 Identity:48/112 - (42%)
Similarity:58/112 - (51%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKTFQAYLPSTNRTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTG 65
            |.:.|.....:....|.||.|..:|....||.||:|.||.|||.||....||..|:.|.|.:.||
 Worm     1 MGRQFAGICGARGSLYGCVVCNTYLTCSKELTSKAFTGSTGPATLFKRAWNVVYGRCEHRKMTTG 65

  Fly    66 LHAVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENG 112
            .|.|.|::|..|...|||.||.|...||.|||.:.|||.|:..|..|
 Worm    66 WHTVRDVFCVTCNQKLGWMYEMAVSESQTYKETQVIIENANFEKIAG 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15309NP_001096936.1 RLR_C_like 15..103 CDD:416942 41/87 (47%)
B0546.4NP_500335.1 Yippee-Mis18 14..108 CDD:281250 44/93 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.