DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15309 and F37A8.5

DIOPT Version :9

Sequence 1:NP_001096936.1 Gene:CG15309 / 31949 FlyBaseID:FBgn0030183 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_497796.1 Gene:F37A8.5 / 175512 WormBaseID:WBGene00009503 Length:137 Species:Caenorhabditis elegans


Alignment Length:112 Identity:93/112 - (83%)
Similarity:102/112 - (91%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTFQAYLPSTNRTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLH 67
            ||||.|||:.:|.|||:||||:||:|.||||||||||||.|||||:||||.||..||||||||||
 Worm    21 KTFQHYLPAGDRCYSCIHCRANLAAHAELISKSFQGSQGKAYLFNAVVNVGCGPAEERVLLTGLH 85

  Fly    68 AVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGWD 114
            ||||||||.|||.||||||||:||||||||||||||||||:|:||||
 Worm    86 AVADIYCEICKTTLGWKYEHAFESSQKYKEGKFIIELAHMVKDNGWD 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15309NP_001096936.1 RLR_C_like 15..103 CDD:416942 74/87 (85%)
F37A8.5NP_497796.1 RLR_C_like 33..123 CDD:300620 76/89 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 173 1.000 Domainoid score I2226
eggNOG 1 0.900 - - E1_KOG3399
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 203 1.000 Inparanoid score I2457
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 1 1.000 - - oto17819
orthoMCL 1 0.900 - - OOG6_100480
Panther 1 1.100 - - LDO PTHR13848
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2192
SonicParanoid 1 1.000 - - X404
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.