DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ypel and Ypel1

DIOPT Version :10

Sequence 1:NP_572609.1 Gene:Ypel / 31949 FlyBaseID:FBgn0030183 Length:114 Species:Drosophila melanogaster
Sequence 2:XP_006521738.1 Gene:Ypel1 / 106369 MGIID:1913303 Length:217 Species:Mus musculus


Alignment Length:87 Identity:73/87 - (83%)
Similarity:77/87 - (88%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTFQAYLPSTNRTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTGLH 67
            ||||||||..:|||||:|||||||:||||||||||||||.||||||||||.||..||||||||||
Mouse    95 KTFQAYLPHCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLH 159

  Fly    68 AVADIYCECCKTPLGWKYEHAY 89
            ||||||||.|||.|||||..|:
Mouse   160 AVADIYCENCKTTLGWKYGRAH 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YpelNP_572609.1 RLR_C_like 15..105 CDD:472430 64/75 (85%)
Ypel1XP_006521738.1 None

Return to query results.
Submit another query.