DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15309 and ypel5

DIOPT Version :9

Sequence 1:NP_001096936.1 Gene:CG15309 / 31949 FlyBaseID:FBgn0030183 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001313382.1 Gene:ypel5 / 100332089 ZFINID:ZDB-GENE-040426-1220 Length:121 Species:Danio rerio


Alignment Length:114 Identity:49/114 - (42%)
Similarity:72/114 - (63%) Gaps:1/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKTFQAYLPSTNRTYSCVHCRAHLASHDELISKSFQGSQGPAYLFNSVVNVACGQTEERVLLTG 65
            |.:.|..::..| |.:||.:|...|.:..||||..|.|:.|.|:|||.|||:...:.::||:|||
Zfish     1 MGRIFLDHIGGT-RLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTG 64

  Fly    66 LHAVADIYCECCKTPLGWKYEHAYESSQKYKEGKFIIELAHMIKENGWD 114
            .|.|.|:.|:.|.:.|||.||.|.|.||:||||:.|:|.|.:.:..|::
Zfish    65 RHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFE 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15309NP_001096936.1 RLR_C_like 15..103 CDD:416942 42/87 (48%)
ypel5NP_001313382.1 RLR_C_like 15..107 CDD:416942 44/91 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53853
OrthoDB 1 1.010 - - D1431042at2759
OrthoFinder 1 1.000 - - FOG0000384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2192
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.