DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43902 and npm2a

DIOPT Version :10

Sequence 1:NP_572608.2 Gene:CG43902 / 31948 FlyBaseID:FBgn0264503 Length:1220 Species:Drosophila melanogaster
Sequence 2:NP_001186842.1 Gene:npm2a / 797865 ZFINID:ZDB-GENE-060810-57 Length:156 Species:Danio rerio


Alignment Length:69 Identity:16/69 - (23%)
Similarity:31/69 - (44%) Gaps:16/69 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SKTMSLAAL-----ILGLMGLALV-----TLAAGNDA--ISAPKAGKD----LQQQRHQQPSEIE 64
            ||.:.:|.|     ::...||.|:     .|.:|...  :||.....:    ::::..::..|.|
Zfish    88 SKPLPIATLRHCMPMISFPGLELIPPVTFKLCSGKGPVFVSAQHITLNPIEMIEEEEEEKQDEEE 152

  Fly    65 DDDG 68
            |:||
Zfish   153 DEDG 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43902NP_572608.2 None
npm2aNP_001186842.1 NPL 37..132 CDD:470892 11/43 (26%)

Return to query results.
Submit another query.